PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.5224s0008.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 677aa    MW: 74428.3 Da    PI: 6.873
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.5224s0008.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-094755121954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   n+yps +++  LA+++gL+ +qV++WF N R +
  Cagra.5224s0008.2.p 475 FEHflNPYPSDADKHLLARQTGLSRNQVSNWFINARVR 512
                          665569******************************88 PP

2BELL124.15.4e-40333404172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +r e+q++k+kLls+leeVd+rY++y+eq+q+v++sF++v+g+g+a pYt+lA+ka+SrhFrcLkda+a q+
  Cagra.5224s0008.2.p 333 DRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYTTLAQKAMSRHFRCLKDAVAAQL 404
                          589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-84255402IPR006563POX domain
PfamPF075267.2E-51261401IPR006563POX domain
PROSITE profilePS5007112.86453516IPR001356Homeobox domain
SMARTSM003891.1E-9456520IPR001356Homeobox domain
CDDcd000861.22E-12456517No hitNo description
SuperFamilySSF466891.37E-17457523IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28459522IPR009057Homeodomain-like
PfamPF059203.1E-18473512IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MGLVTTTTTT TLLHHQDLDS SSSMSQDYHH HHHHHQGIFS FSNGFHRSSS TTHQEEVDES  60
AVSGTAQIPV YESSAGMLSE MFAYPGGGGG GGGSSGEILD QSSTKQLLEQ QNRHNSSTLH  120
MLLPNHHQQQ GFAFTDENTI QEQQQQHFTW PSSSDHHQQQ NRDMIGTVHV EGGKGLSLSL  180
SSSLAAAKAE EYRSIYCAAV DGTSSSSNAS AHHHQYNQFK NLLLDNSSSS HHHHHQVVGH  240
FGSSSSSPIA ASSSIGGIYT LRNSKYTKPA QELLEEFCSV GRGHFKKNKL SRNNSNPNTT  300
GGGGGGGGGG GGGGGSSSSA GTANDSPPIS PADRIEHQRR KVKLLSMLEE VDRRYNHYCE  360
QMQMVVNSFD QVMGYGAAVP YTTLAQKAMS RHFRCLKDAV AAQLKRSCEL LGDKEGAGAA  420
SSGLTKGETP RLRLLEQSLR QQRAFHHMGM MEQEAWRPQR GLPERSVNIL RAWLFEHFLN  480
PYPSDADKHL LARQTGLSRN QVSNWFINAR VRLWKPMVEE MYQQEAKERE REEANENENE  540
NEQQRRQQQT NNNNNNNNDT KPNNNNENNF TTHVITTQTP TTMTSTHHDN DPSFLPSIVA  600
AASHGCSDAF TVTTCHQQDV VVSDFHVIDG AANVIRFGTK QPGDVSLTLG LRHSGNIPDN  660
NNNTSSFSVR DFGDFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-16462519158Homeobox protein Meis1
4xrs_B5e-16462519158Homeobox protein Meis1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1299315TGGGGGGGGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293804.10.0hypothetical protein CARUB_v10022787mg
RefseqXP_006293805.10.0hypothetical protein CARUB_v10022787mg
SwissprotQ94KL50.0BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLR0FUV80.0R0FUV8_9BRAS; Uncharacterized protein
STRINGscaffold_400362.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.30.0BEL1-like homeodomain 4